Lineage for d1rwra_ (1rwr A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422942Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2422943Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2423116Family b.80.1.11: Filamentous hemagglutinin FhaB, secretion domain [101957] (1 protein)
    this is a repeat family; one repeat unit is 1rwr A:258-278 found in domain
  6. 2423117Protein Filamentous hemagglutinin FhaB, secretion domain [101958] (1 species)
  7. 2423118Species Bordetella pertussis [TaxId:520] [101959] (1 PDB entry)
  8. 2423119Domain d1rwra_: 1rwr A: [97990]

Details for d1rwra_

PDB Entry: 1rwr (more details), 1.72 Å

PDB Description: Crystal structure of filamentous hemagglutinin secretion domain
PDB Compounds: (A:) Filamentous hemagglutinin

SCOPe Domain Sequences for d1rwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwra_ b.80.1.11 (A:) Filamentous hemagglutinin FhaB, secretion domain {Bordetella pertussis [TaxId: 520]}
qglvpqgqtqvlqggnkvpvvniadpnsggvshnkfqqfnvanpgvvfnngltdgvsrig
galtknpnltrqasailaevtdtspsrlagtlevygkgadliianpngisvnglstlnas
nltlttgrpsvnggrigldvqqgtvtierggvnatglgyfdvvarlvklqgavsskqgkp
ladiavvaganrydhatrratpiaagargaaagayaidgtaagamygkhitlvssdsglg
vrqlgslsspsaitvssqgeialgdatvqrgplslkgagvvsagklasgggavnvag

SCOPe Domain Coordinates for d1rwra_:

Click to download the PDB-style file with coordinates for d1rwra_.
(The format of our PDB-style files is described here.)

Timeline for d1rwra_: