SCOP 1.73: Domain d1rv6w_: 1rv6 W:

Lineage for d1rv6w_ (1rv6 W:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries)

8. Domain d1rv6w_: 1rv6 W: [97913]
   Other proteins in same PDB: d1rv6x_, d1rv6y_
   complexed with b3p

Details for d1rv6w_

PDB Entry: 1rv6, 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1

PDB Compounds: (W:) placenta growth factor (PlGF)

SCOP Domain Sequences for d1rv6w_:

Sequence; same for both SEQRES and ATOM records:

>d1rv6w_ g.17.1.1 (W:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens) [TaxId: 9606]}
evvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpve
tanvtmqllkirsgdrpsyveltfsqhvrcecrpl

Timeline for d1rv6w_:

• d1rv6w_ first appeared in SCOP 1.67
  
• d1rv6w_ appears in SCOP 1.71
  
• d1rv6w_ appears in SCOP 1.75
  
• d1rv6w_ appears in the current release, SCOPe 2.08