Lineage for d1rv6v_ (1rv6 V:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749103Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 749104Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 749105Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 749106Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)
  7. 749107Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries)
  8. 749110Domain d1rv6v_: 1rv6 V: [97912]
    Other proteins in same PDB: d1rv6x_, d1rv6y_

Details for d1rv6v_

PDB Entry: 1rv6 (more details), 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1
PDB Compounds: (V:) placenta growth factor (PlGF)

SCOP Domain Sequences for d1rv6v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv6v_ g.17.1.1 (V:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens) [TaxId: 9606]}
vvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpvet
anvtmqllkirsgdrpsyveltfsqhvrcecrpl

SCOP Domain Coordinates for d1rv6v_:

Click to download the PDB-style file with coordinates for d1rv6v_.
(The format of our PDB-style files is described here.)

Timeline for d1rv6v_: