Lineage for d1rv6w_ (1rv6 W:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623356Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 623357Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 623358Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 623359Protein Placenta growth factor-1, PLGF-1 [64560] (1 species)
  7. 623360Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries)
  8. 623364Domain d1rv6w_: 1rv6 W: [97913]
    Other proteins in same PDB: d1rv6x_, d1rv6y_
    complexed with b3p

Details for d1rv6w_

PDB Entry: 1rv6 (more details), 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1

SCOP Domain Sequences for d1rv6w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv6w_ g.17.1.1 (W:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens)}
evvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpve
tanvtmqllkirsgdrpsyveltfsqhvrcecrpl

SCOP Domain Coordinates for d1rv6w_:

Click to download the PDB-style file with coordinates for d1rv6w_.
(The format of our PDB-style files is described here.)

Timeline for d1rv6w_: