Lineage for d1rrta2 (1rrt A:231-360)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417356Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 417357Superfamily d.113.1: Nudix [55811] (4 families) (S)
  5. 417455Family d.113.1.3: Adenine glycosylase MutY, C-terminal domain [103211] (1 protein)
  6. 417456Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 417457Species Bacillus stearothermophilus [TaxId:1422] [103213] (3 PDB entries)
  8. 417460Domain d1rrta2: 1rrt A:231-360 [97803]
    Other proteins in same PDB: d1rrta1
    complexed with 8og, a, ca, fs4, hpd; mutant

Details for d1rrta2

PDB Entry: 1rrt (more details), 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base

SCOP Domain Sequences for d1rrta2:

Sequence, based on SEQRES records: (download)

>d1rrta2 d.113.1.3 (A:231-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus}
ktavkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqy
glqveltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqr
vwreykewas

Sequence, based on observed residues (ATOM records): (download)

>d1rrta2 d.113.1.3 (A:231-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus}
ktavkqvplavavladdegrvlirkrdstgllanlwefpscetddgkekleqmvglqvel
tepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyk
ewas

SCOP Domain Coordinates for d1rrta2:

Click to download the PDB-style file with coordinates for d1rrta2.
(The format of our PDB-style files is described here.)

Timeline for d1rrta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rrta1