SCOP 1.67: Domain d1rrta1: 1rrt A:9-230

Lineage for d1rrta1 (1rrt A:9-230)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (5 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries)

8. Domain d1rrta1: 1rrt A:9-230 [97802]
   Other proteins in same PDB: d1rrta2
   complexed with 8og, a, ca, fs4, hpd; mutant

Details for d1rrta1

PDB Entry: 1rrt, 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base

SCOP Domain Sequences for d1rrta1:

Sequence; same for both SEQRES and ATOM records:

>d1rrta1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

Timeline for d1rrta1:

• d1rrta1 is new in SCOP 1.67
  
• d1rrta1 appears in SCOP 1.69
  
• d1rrta1 last appears in SCOP 1.71