Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (5 families) |
Family d.113.1.3: Adenine glycosylase MutY, C-terminal domain [103211] (1 protein) |
Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [103213] (3 PDB entries) |
Domain d1rrta2: 1rrt A:231-360 [97803] Other proteins in same PDB: d1rrta1 complexed with 8og, a, ca, fs4, hpd; mutant |
PDB Entry: 1rrt (more details), 2.5 Å
SCOP Domain Sequences for d1rrta2:
Sequence, based on SEQRES records: (download)
>d1rrta2 d.113.1.3 (A:231-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus} ktavkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqy glqveltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqr vwreykewas
>d1rrta2 d.113.1.3 (A:231-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus} ktavkqvplavavladdegrvlirkrdstgllanlwefpscetddgkekleqmvglqvel tepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyk ewas
Timeline for d1rrta2: