Lineage for d1rrta1 (1rrt A:9-230)
- Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily)
multihelical; consists of two all-alpha domainsSuperfamily a.96.1: DNA-glycosylase [48150] (5 families) 
Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins) Protein Catalytic domain of MutY [48155] (2 species) 
Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries) 
Domain d1rrta1: 1rrt A:9-230 [97802]
Other proteins in same PDB: d1rrta2
Details for d1rrta1
PDB Entry: 1rrt (more details), 2.5 Å
PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base
SCOP Domain Sequences for d1rrta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrta1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk
SCOP Domain Coordinates for d1rrta1:
Click to download the PDB-style file with coordinates for d1rrta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rrta1:
- d1rrta1 first appeared in SCOP 1.67
- d1rrta1 last appears in SCOP 1.71
View in 3D
