Lineage for d1rrta1 (1rrt A:9-230)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541438Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 541439Superfamily a.96.1: DNA-glycosylase [48150] (6 families) (S)
  5. 541447Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins)
  6. 541448Protein Catalytic domain of MutY [48155] (2 species)
  7. 541449Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries)
  8. 541452Domain d1rrta1: 1rrt A:9-230 [97802]
    Other proteins in same PDB: d1rrta2
    complexed with 8og, a, ca, fs4, hpd; mutant

Details for d1rrta1

PDB Entry: 1rrt (more details), 2.5 Å

PDB Description: MutY adenine glycosylase in complex with DNA and soaked adenine free base

SCOP Domain Sequences for d1rrta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrta1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

SCOP Domain Coordinates for d1rrta1:

Click to download the PDB-style file with coordinates for d1rrta1.
(The format of our PDB-style files is described here.)

Timeline for d1rrta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rrta2