Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) automatically mapped to Pfam PF03717 |
Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins) contains an insert subdomain of ClpS-like fold |
Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species) the insert subdomain (residues 93-183) is usually disordered in the structures |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56522] (6 PDB entries) |
Domain d1rp5a3: 1rp5 A:64-263 [97696] Other proteins in same PDB: d1rp5a1, d1rp5a2, d1rp5a4, d1rp5b1, d1rp5b2, d1rp5b4 the insert subdomain is fully ordered complexed with so4 |
PDB Entry: 1rp5 (more details), 3 Å
SCOPe Domain Sequences for d1rp5a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rp5a3 d.175.1.1 (A:64-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} kvhqttrtvpakrgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkva evfhkyldmeesyvreqlsqpnlkqvsfgakgngityanmmsikkeletaevkgidftts pnrsypngqfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgn ivpgteqvsqqtvdgkdvyt
Timeline for d1rp5a3:
View in 3D Domains from other chains: (mouse over for more information) d1rp5b1, d1rp5b2, d1rp5b3, d1rp5b4 |