Lineage for d1rp5a2 (1rp5 A:693-750)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175821Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2175822Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2175823Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 2175824Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 2175825Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 2175849Domain d1rp5a2: 1rp5 A:693-750 [97695]
    Other proteins in same PDB: d1rp5a3, d1rp5a4, d1rp5b3, d1rp5b4
    complexed with so4

Details for d1rp5a2

PDB Entry: 1rp5 (more details), 3 Å

PDB Description: PBP2x from Streptococcus pneumoniae strain 5259 with reduced susceptibility to beta-lactam antibiotics
PDB Compounds: (A:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1rp5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp5a2 d.11.1.1 (A:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aeevpdmygwtketaetfakwlnielefegsgstvqkqdvrantaikdikkikltlgd

SCOPe Domain Coordinates for d1rp5a2:

Click to download the PDB-style file with coordinates for d1rp5a2.
(The format of our PDB-style files is described here.)

Timeline for d1rp5a2: