Lineage for d1rp3e1 (1rp3 E:87-163)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260797Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1260802Protein Sigma factor sigma-28 (FliA) [101055] (1 species)
  7. 1260803Species Aquifex aeolicus [TaxId:63363] [101056] (2 PDB entries)
  8. 1260806Domain d1rp3e1: 1rp3 E:87-163 [97686]
    Other proteins in same PDB: d1rp3a2, d1rp3a3, d1rp3b_, d1rp3c2, d1rp3c3, d1rp3d_, d1rp3e2, d1rp3e3, d1rp3f_, d1rp3g2, d1rp3g3, d1rp3h_

Details for d1rp3e1

PDB Entry: 1rp3 (more details), 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm
PDB Compounds: (E:) RNA polymerase sigma factor SIGMA-28 (FliA)

SCOPe Domain Sequences for d1rp3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp3e1 a.4.13.1 (E:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
gsrqvrekerrikevveklkeklgreptdeevakelgisteelfktldkinfsyilslee
vfrdfardyselipsst

SCOPe Domain Coordinates for d1rp3e1:

Click to download the PDB-style file with coordinates for d1rp3e1.
(The format of our PDB-style files is described here.)

Timeline for d1rp3e1: