SCOP 1.67: Domain d1rp3e1: 1rp3 E:87-163

Lineage for d1rp3e1 (1rp3 E:87-163)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families)

5. Family a.4.13.1: Sigma3 domain [88660] (3 proteins)

6. Protein Sigma factor sigma-28 (FliA) [101055] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [101056] (2 PDB entries)

8. Domain d1rp3e1: 1rp3 E:87-163 [97686]
   Other proteins in same PDB: d1rp3a2, d1rp3a3, d1rp3b_, d1rp3c2, d1rp3c3, d1rp3d_, d1rp3e2, d1rp3e3, d1rp3f_, d1rp3g2, d1rp3g3, d1rp3h_

Details for d1rp3e1

PDB Entry: 1rp3, 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm

SCOP Domain Sequences for d1rp3e1:

Sequence; same for both SEQRES and ATOM records:

>d1rp3e1 a.4.13.1 (E:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus}
gsrqvrekerrikevveklkeklgreptdeevakelgisteelfktldkinfsyilslee
vfrdfardyselipsst

Timeline for d1rp3e1:

• d1rp3e1 is new in SCOP 1.67
  
• d1rp3e1 appears in SCOP 1.69
  
• d1rp3e1 appears in the current release, SCOPe 2.08