Lineage for d1rp3c2 (1rp3 C:164-235)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260831Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1260832Protein Sigma factor sigma-28 (FliA) [101057] (1 species)
  7. 1260833Species Aquifex aeolicus [TaxId:63363] [101058] (2 PDB entries)
  8. 1260835Domain d1rp3c2: 1rp3 C:164-235 [97683]
    Other proteins in same PDB: d1rp3a1, d1rp3a3, d1rp3b_, d1rp3c1, d1rp3c3, d1rp3d_, d1rp3e1, d1rp3e3, d1rp3f_, d1rp3g1, d1rp3g3, d1rp3h_

Details for d1rp3c2

PDB Entry: 1rp3 (more details), 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm
PDB Compounds: (C:) RNA polymerase sigma factor SIGMA-28 (FliA)

SCOPe Domain Sequences for d1rp3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp3c2 a.4.13.2 (C:164-235) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
nveeevikreltekvkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkak
alerlremlsnp

SCOPe Domain Coordinates for d1rp3c2:

Click to download the PDB-style file with coordinates for d1rp3c2.
(The format of our PDB-style files is described here.)

Timeline for d1rp3c2: