SCOPe 2.06: Domain d1rp3c2: 1rp3 C:164-235

Lineage for d1rp3c2 (1rp3 C:164-235)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.2: Sigma4 domain [88665] (5 proteins)

6. Protein Sigma factor sigma-28 (FliA) [101057] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [101058] (2 PDB entries)

8. Domain d1rp3c2: 1rp3 C:164-235 [97683]
   Other proteins in same PDB: d1rp3a1, d1rp3a3, d1rp3a4, d1rp3b_, d1rp3c1, d1rp3c3, d1rp3d_, d1rp3e1, d1rp3e3, d1rp3f_, d1rp3g1, d1rp3g3, d1rp3h_

Details for d1rp3c2

PDB Entry: 1rp3, 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm

PDB Compounds: (C:) RNA polymerase sigma factor SIGMA-28 (FliA)

SCOPe Domain Sequences for d1rp3c2:

Sequence; same for both SEQRES and ATOM records:

>d1rp3c2 a.4.13.2 (C:164-235) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
nveeevikreltekvkeavsklpereklviqlifyeelpakevakiletsvsrvsqlkak
alerlremlsnp

Timeline for d1rp3c2:

• d1rp3c2 first appeared in SCOP 1.67
  
• d1rp3c2 appears in SCOPe 2.05
  
• d1rp3c2 appears in SCOPe 2.07
  
• d1rp3c2 appears in the current release, SCOPe 2.08