Lineage for d1rp3e3 (1rp3 E:2-86)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018296Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2018297Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2018298Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2018303Protein Sigma factor sigma-28 (FliA) [101383] (1 species)
  7. 2018304Species Aquifex aeolicus [TaxId:63363] [101384] (2 PDB entries)
  8. 2018307Domain d1rp3e3: 1rp3 E:2-86 [97688]
    Other proteins in same PDB: d1rp3a1, d1rp3a2, d1rp3a4, d1rp3b_, d1rp3c1, d1rp3c2, d1rp3d_, d1rp3e1, d1rp3e2, d1rp3f_, d1rp3g1, d1rp3g2, d1rp3h_

Details for d1rp3e3

PDB Entry: 1rp3 (more details), 2.3 Å

PDB Description: cocrystal structure of the flagellar sigma/anti-sigma complex, sigma- 28/flgm
PDB Compounds: (E:) RNA polymerase sigma factor SIGMA-28 (FliA)

SCOPe Domain Sequences for d1rp3e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp3e3 a.177.1.1 (E:2-86) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
knpysnqiereelilkylplvkaiatnikkhlpedvdirdlisygviglikavdnlsten
pkraeayiklrikgaiydylrsldf

SCOPe Domain Coordinates for d1rp3e3:

Click to download the PDB-style file with coordinates for d1rp3e3.
(The format of our PDB-style files is described here.)

Timeline for d1rp3e3: