Lineage for d1rlic_ (1rli C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465103Family c.23.5.6: Hypothetical protein YwqN [102237] (1 protein)
    automatically mapped to Pfam PF03358
    automatically mapped to Pfam PF02525
  6. 2465104Protein Hypothetical protein YwqN [102238] (1 species)
    Trp repressor binding protein
  7. 2465105Species Bacillus subtilis [TaxId:1423] [102239] (1 PDB entry)
  8. 2465108Domain d1rlic_: 1rli C: [97649]
    complexed with po4, pt

Details for d1rlic_

PDB Entry: 1rli (more details), 1.8 Å

PDB Description: The Structure of Trp Repressor Binding Protein from Bacillus subtilis
PDB Compounds: (C:) Trp Repressor Binding Protein

SCOPe Domain Sequences for d1rlic_:

Sequence, based on SEQRES records: (download)

>d1rlic_ c.23.5.6 (C:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]}
kiavinggtrsggntdvlaekavqgfdaehiylqkypiqpiedlrhaqggfrpvqddyds
iierilqchilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavg
gdnpkikglpliqqfehifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrll

Sequence, based on observed residues (ATOM records): (download)

>d1rlic_ c.23.5.6 (C:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]}
kiavinggtrsggntdvlaekavqgfdaehiylqkypaqggfrpvqddydsiierilqch
ilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavggdnpkikgl
pliqqfehifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrll

SCOPe Domain Coordinates for d1rlic_:

Click to download the PDB-style file with coordinates for d1rlic_.
(The format of our PDB-style files is described here.)

Timeline for d1rlic_: