![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.6: Hypothetical protein YwqN [102237] (1 protein) automatically mapped to Pfam PF03358 automatically mapped to Pfam PF02525 |
![]() | Protein Hypothetical protein YwqN [102238] (1 species) Trp repressor binding protein |
![]() | Species Bacillus subtilis [TaxId:1423] [102239] (1 PDB entry) |
![]() | Domain d1rlic_: 1rli C: [97649] complexed with po4, pt |
PDB Entry: 1rli (more details), 1.8 Å
SCOPe Domain Sequences for d1rlic_:
Sequence, based on SEQRES records: (download)
>d1rlic_ c.23.5.6 (C:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} kiavinggtrsggntdvlaekavqgfdaehiylqkypiqpiedlrhaqggfrpvqddyds iierilqchilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavg gdnpkikglpliqqfehifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrll
>d1rlic_ c.23.5.6 (C:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} kiavinggtrsggntdvlaekavqgfdaehiylqkypaqggfrpvqddydsiierilqch ilifatpiywfgmsgtlklfidrwsqtlrdprfpdfkqqmsvkqayviavggdnpkikgl pliqqfehifhfmgmsfkgyvlgegnrpgdilrdhqalsaasrll
Timeline for d1rlic_: