SCOP 1.73: Domain d1rkqb_: 1rkq B:

Lineage for d1rkqb_ (1rkq B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Hypothetical protein YidA [102315] (1 species)

7. Species Escherichia coli [TaxId:562] [102316] (1 PDB entry)

8. Domain d1rkqb_: 1rkq B: [97622]
   structural genomics; NYSGRC target T1436
   complexed with cl, mo3

Details for d1rkqb_

PDB Entry: 1rkq, 1.4 Å

PDB Description: crystal structure of had-like phosphatase yida from e. coli

PDB Compounds: (B:) Hypothetical protein yidA

SCOP Domain Sequences for d1rkqb_:

Sequence; same for both SEQRES and ATOM records:

>d1rkqb_ c.108.1.10 (B:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]}
slaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhm
eqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytan
rdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekyt
vlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdn
aipsvkevanfvtksnledgvafaiekyvln

Timeline for d1rkqb_:

• d1rkqb_ first appeared in SCOP 1.67
  
• d1rkqb_ appears in SCOP 1.71
  
• d1rkqb_ appears in SCOP 1.75
  
• d1rkqb_ appears in the current release, SCOPe 2.08, called d1rkqb1