![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein Hypothetical protein YidA [102315] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102316] (1 PDB entry) |
![]() | Domain d1rkqb1: 1rkq B:3-271 [97622] Other proteins in same PDB: d1rkqa2, d1rkqb2 structural genomics; NYSGRC target T1436 complexed with cl, mg |
PDB Entry: 1rkq (more details), 1.4 Å
SCOPe Domain Sequences for d1rkqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkqb1 c.108.1.10 (B:3-271) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} aikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhmeq pgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytanrd isyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekytvl ksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdnai psvkevanfvtksnledgvafaiekyvln
Timeline for d1rkqb1: