Lineage for d1rkqb_ (1rkq B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594610Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 594611Superfamily c.108.1: HAD-like [56784] (18 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 594745Family c.108.1.10: Predicted hydrolases Cof [82388] (6 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 594751Protein Hypothetical protein YidA [102315] (1 species)
  7. 594752Species Escherichia coli [TaxId:562] [102316] (1 PDB entry)
  8. 594754Domain d1rkqb_: 1rkq B: [97622]
    structural genomics; NYSGRC target T1436
    complexed with cl, mo3

Details for d1rkqb_

PDB Entry: 1rkq (more details), 1.4 Å

PDB Description: crystal structure of had-like phosphatase yida from e. coli

SCOP Domain Sequences for d1rkqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkqb_ c.108.1.10 (B:) Hypothetical protein YidA {Escherichia coli}
slaikliaidmdgtlllpdhtispavknaiaaarargvnvvlttgrpyagvhnylkelhm
eqpgdycityngalvqkaadgstvaqtalsyddyrfleklsrevgshfhaldrttlytan
rdisyytvhesfvatiplvfceaekmdpntqflkvmmidepaildqaiaripqevkekyt
vlksapyfleildkrvnkgtgvksladvlgikpeeimaigdqendiamieyagvgvavdn
aipsvkevanfvtksnledgvafaiekyvln

SCOP Domain Coordinates for d1rkqb_:

Click to download the PDB-style file with coordinates for d1rkqb_.
(The format of our PDB-style files is described here.)

Timeline for d1rkqb_: