Class a: All alpha proteins [46456] (285 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein Vinculin [47224] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101111] (9 PDB entries) Uniprot P18206 1-257 |
Domain d1rkea2: 1rke A:129-258 [97609] head domain; contains two domains of this fold; complexed with separate tail domain of the same or closely related protein |
PDB Entry: 1rke (more details), 2.35 Å
SCOPe Domain Sequences for d1rkea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkea2 a.24.9.1 (A:129-258) Vinculin {Human (Homo sapiens) [TaxId: 9606]} aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl qltswdedaw
Timeline for d1rkea2: