SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1rkea2 (1rke A:129-258)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987801Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1987802Family a.24.9.1: alpha-catenin/vinculin [47221] (3 protein domains)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1987818Protein Vinculin [47224] (2 species)
  7. 1987832Species Human (Homo sapiens) [TaxId:9606] [101111] (15 PDB entries)
    Uniprot P18206 1-257
  8. 1987846Domain d1rkea2: 1rke A:129-258 [97609]
    Other proteins in same PDB: d1rkea3
    head domain; contains two domains of this fold; complexed with separate tail domain of the same or closely related protein

Details for d1rkea2

PDB Entry: 1rke (more details), 2.35 Å

PDB Description: Human vinculin head (1-258) in complex with human vinculin tail (879-1066)
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1rkea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkea2 a.24.9.1 (A:129-258) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswdedaw

SCOPe Domain Coordinates for d1rkea2:

Click to download the PDB-style file with coordinates for d1rkea2.
(The format of our PDB-style files is described here.)

Timeline for d1rkea2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rkeb_