SCOP 1.75: Domain d1riob_: 1rio B:

Lineage for d1riob_ (1rio B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries)

8. Domain d1riob_: 1rio B: [97514]
   Other proteins in same PDB: d1rioh_
   complexed with ca, mpd

Details for d1riob_

PDB Entry: 1rio, 2.3 Å

PDB Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA

PDB Compounds: (B:) repressor protein ci

SCOP Domain Sequences for d1riob_:

Sequence; same for both SEQRES and ATOM records:

>d1riob_ a.35.1.2 (B:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
naallakilkvsveefspsiareiyemyeavhhhhh

Timeline for d1riob_:

• d1riob_ first appeared in SCOP 1.67
  
• d1riob_ appears in SCOP 1.73
  
• d1riob_ appears in SCOPe 2.01
  
• d1riob_ appears in the current release, SCOPe 2.08, called d1riob1