PDB entry 1rio

View 1rio on RCSB PDB site
Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA
Class: transcription/DNA
Keywords: helix-turn-helix, transcription activation
Deposited on 2003-11-17, released 2004-01-27
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: repressor protein ci
    Species: Bacteriophage lambda
    Gene: CI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03034 (Start-91)
      • modified residue (40)
      • modified residue (42)
      • modified residue (87)
      • his tag (92-97)
    Domains in SCOP 1.75: d1rioa_
  • Chain 'B':
    Compound: repressor protein ci
    Species: Bacteriophage lambda
    Gene: CI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03034 (Start-91)
      • modified residue (40)
      • modified residue (42)
      • modified residue (87)
      • his tag (92-96)
    Domains in SCOP 1.75: d1riob_
  • Chain 'H':
    Compound: sigma factor sigA
    Species: Thermus aquaticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rioh_
  • Chain 'T':
    Compound: 27-mer
  • Chain 'U':
    Compound: 27-mer
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rioA (A:)
    mstkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalna
    ynaallakilkvsveefspsiareiyemyeavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rioA (A:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rioB (B:)
    mstkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalna
    ynaallakilkvsveefspsiareiyemyeavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rioB (B:)
    stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
    naallakilkvsveefspsiareiyemyeavhhhhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rioH (H:)
    seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky
    hesrtrklrdfle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rioH (H:)
    seelekalsklsereamvlklrkglidgrehtleevgayfgvtrerirqienkalrklky
    h
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.