SCOP 1.75: Domain d1rioa_: 1rio A:

Lineage for d1rioa_ (1rio A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [47421] (4 PDB entries)

8. Domain d1rioa_: 1rio A: [97513]
   Other proteins in same PDB: d1rioh_

Details for d1rioa_

PDB Entry: 1rio, 2.3 Å

PDB Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA

PDB Compounds: (A:) repressor protein ci

SCOP Domain Sequences for d1rioa_:

Sequence; same for both SEQRES and ATOM records:

>d1rioa_ a.35.1.2 (A:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
naallakilkvsveefspsiareiyemyeavhhhhhh

Timeline for d1rioa_:

• d1rioa_ first appeared in SCOP 1.67
  
• d1rioa_ appears in SCOP 1.73
  
• d1rioa_ appears in SCOPe 2.01
  
• d1rioa_ appears in the current release, SCOPe 2.08, called d1rioa1