Lineage for d1rfqa1 (1rfq A:5-146)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995079Protein Actin [53073] (6 species)
  7. 995164Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (20 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 995207Domain d1rfqa1: 1rfq A:5-146 [97396]
    complexed with atp, lar, mg

Details for d1rfqa1

PDB Entry: 1rfq (more details), 3 Å

PDB Description: Actin Crystal Dynamics: Structural Implications for F-actin Nucleation, Polymerization and Branching Mediated by the Anti-parallel Dimer
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1rfqa1:

Sequence, based on SEQRES records: (download)

>d1rfqa1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1rfqa1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

SCOPe Domain Coordinates for d1rfqa1:

Click to download the PDB-style file with coordinates for d1rfqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rfqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rfqa2