Lineage for d1rfqa1 (1rfq A:5-146)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397316Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 397317Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 397318Protein Actin [53073] (6 species)
  7. 397337Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (17 PDB entries)
  8. 397374Domain d1rfqa1: 1rfq A:5-146 [97396]

Details for d1rfqa1

PDB Entry: 1rfq (more details), 3 Å

PDB Description: Actin Crystal Dynamics: Structural Implications for F-actin Nucleation, Polymerization and Branching Mediated by the Anti-parallel Dimer

SCOP Domain Sequences for d1rfqa1:

Sequence, based on SEQRES records: (download)

>d1rfqa1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d1rfqa1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus)}
ttalvcdngsglvkagfagddapravfpsivgrprhdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

SCOP Domain Coordinates for d1rfqa1:

Click to download the PDB-style file with coordinates for d1rfqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rfqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rfqa2