SCOP 1.71: Domain d1rd3.2: 1rd3 C:,D:

Lineage for d1rd3.2 (1rd3 C:,D:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (157 PDB entries)

8. Domain d1rd3.2: 1rd3 C:,D: [97303]
   complexed with fuc, gol, man, nag, po4; mutant

Details for d1rd3.2

PDB Entry: 1rd3, 2.5 Å

PDB Description: 2.5a structure of anticoagulant thrombin variant e217k

SCOP Domain Sequences for d1rd3.2:

Sequence; same for both SEQRES and ATOM records:

>g1rd3.2 b.47.1.2 (C:,D:) Thrombin {Human (Homo sapiens)}
sgeadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellc
gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp
rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw
tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp
fvmkspfnnrwyqmgivswgkgcdrdgkygfythvfrlkkwiqkvidqfg

Timeline for d1rd3.2:

• d1rd3.2 first appeared in SCOP 1.67
  
• d1rd3.2 appears in SCOP 1.69
  
• d1rd3.2 appears in SCOP 1.73
  
• d1rd3.2 appears in the current release, SCOPe 2.08