Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries) |
Domain d1rd3.2: 1rd3 C:,D: [97303] complexed with fuc, gol, man, nag, po4; mutant |
PDB Entry: 1rd3 (more details), 2.5 Å
SCOP Domain Sequences for d1rd3.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1rd3.2 b.47.1.2 (C:,D:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} sgeadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellc gaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihp rynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketw tanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggp fvmkspfnnrwyqmgivswgkgcdrdgkygfythvfrlkkwiqkvidqfg
Timeline for d1rd3.2:
View in 3D Domains from other chains: (mouse over for more information) d1rd3.1, d1rd3.1, d1rd3.1, d1rd3.1 |