SCOPe 2.03: Domain d1rb8g_: 1rb8 G:

Lineage for d1rb8g_ (1rb8 G:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)
   include capsid protein F and spike protein G

7. Species Bacteriophage alpha3 [TaxId:10849] [82008] (2 PDB entries)

8. Domain d1rb8g_: 1rb8 G: [97280]
   protein/DNA complex; complexed with dc

Details for d1rb8g_

PDB Entry: 1rb8, 3.5 Å

PDB Description: the phix174 dna binding protein j in two different capsid environments.

PDB Compounds: (G:) Major spike protein

SCOPe Domain Sequences for d1rb8g_:

Sequence; same for both SEQRES and ATOM records:

>d1rb8g_ b.121.5.1 (G:) Microvirus capsid proteins {Bacteriophage alpha3 [TaxId: 10849]}
myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss
dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy
piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey
qvlqplk

Timeline for d1rb8g_:

• d1rb8g_ first appeared in SCOP 1.67
  
• d1rb8g_ appears in SCOPe 2.02
  
• d1rb8g_ appears in SCOPe 2.04
  
• d1rb8g_ appears in the current release, SCOPe 2.08