Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (3 families) |
Family b.121.5.1: Microviridae-like VP [49612] (1 protein) |
Protein Microvirus capsid proteins [49613] (3 species) include capsid protein F and spike protein G |
Species Bacteriophage alpha3 [TaxId:10849] [82008] (2 PDB entries) |
Domain d1rb8g_: 1rb8 G: [97280] protein/DNA complex; complexed with dc |
PDB Entry: 1rb8 (more details), 3.5 Å
SCOPe Domain Sequences for d1rb8g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rb8g_ b.121.5.1 (G:) Microvirus capsid proteins {Bacteriophage alpha3 [TaxId: 10849]} myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey qvlqplk
Timeline for d1rb8g_: