Lineage for d1rb8g_ (1rb8 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823004Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. 2823005Family b.121.5.1: Microviridae-like VP [49612] (2 proteins)
  6. Protein Microvirus capsid proteins, spike protein G [418933] (3 species)
    protein includes capsid protein F and spike protein G
  7. Species Bacteriophage alpha3 [TaxId:10849] [419367] (2 PDB entries)
  8. 2823020Domain d1rb8g_: 1rb8 G: [97280]
    Other proteins in same PDB: d1rb8f_
    protein/DNA complex; complexed with dc

Details for d1rb8g_

PDB Entry: 1rb8 (more details), 3.5 Å

PDB Description: the phix174 dna binding protein j in two different capsid environments.
PDB Compounds: (G:) Major spike protein

SCOPe Domain Sequences for d1rb8g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rb8g_ b.121.5.1 (G:) Microvirus capsid proteins, spike protein G {Bacteriophage alpha3 [TaxId: 10849]}
myqnfvtkhdtaiqtsrfsvtgnvipaaptgnipvinggsitaeravvnlyanmnvstss
dgsfivamkvdtsptdpncvisagvnlsfagtsypivgivrfesaseqptsiagsevehy
piemsvgsggvcsardcatvdihprtsgnnvfvgvicssakwtsgrvigtiattqvihey
qvlqplk

SCOPe Domain Coordinates for d1rb8g_:

Click to download the PDB-style file with coordinates for d1rb8g_.
(The format of our PDB-style files is described here.)

Timeline for d1rb8g_: