Lineage for d1r9la_ (1r9l A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710943Protein Glycine betaine-binding periplasmic protein ProX [102702] (1 species)
  7. 710944Species Escherichia coli [TaxId:562] [102703] (2 PDB entries)
  8. 710945Domain d1r9la_: 1r9l A: [97262]
    CASP5
    complexed with bet, unx

Details for d1r9la_

PDB Entry: 1r9l (more details), 1.59 Å

PDB Description: structure analysis of prox in complex with glycine betaine
PDB Compounds: (A:) Glycine betaine-binding periplasmic protein

SCOP Domain Sequences for d1r9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9la_ c.94.1.1 (A:) Glycine betaine-binding periplasmic protein ProX {Escherichia coli [TaxId: 562]}
adlpgkgitvnpvqstiteetfqtllvsraleklgytvnkpsevdynvgytslasgdatf
tavnwtplhdnmyeaaggdkkfyregvfvngaaqgylidkktadqykitniaqlkdpkia
klfdtngdgkadltgcnpgwgcegainhqlaayeltntvthnqgnyaammadtisrykeg
kpvfyytwtpywvsnelkpgkdvvwlqvpfsalpgdknadtklpnganygfpvstmhiva
nkawaeknpaaaklfaimqlpvadinaqnaimhdgkasegdiqghvdgwikahqqqfdgw
vnealaaqk

SCOP Domain Coordinates for d1r9la_:

Click to download the PDB-style file with coordinates for d1r9la_.
(The format of our PDB-style files is described here.)

Timeline for d1r9la_: