SCOP 1.75: Domain d1r9la_: 1r9l A:

Lineage for d1r9la_ (1r9l A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Glycine betaine-binding periplasmic protein ProX [102702] (1 species)

7. Species Escherichia coli [TaxId:562] [102703] (2 PDB entries)

8. Domain d1r9la_: 1r9l A: [97262]
   CASP5
   complexed with bet, unx

Details for d1r9la_

PDB Entry: 1r9l, 1.59 Å

PDB Description: structure analysis of prox in complex with glycine betaine

PDB Compounds: (A:) Glycine betaine-binding periplasmic protein

SCOP Domain Sequences for d1r9la_:

Sequence; same for both SEQRES and ATOM records:

>d1r9la_ c.94.1.1 (A:) Glycine betaine-binding periplasmic protein ProX {Escherichia coli [TaxId: 562]}
adlpgkgitvnpvqstiteetfqtllvsraleklgytvnkpsevdynvgytslasgdatf
tavnwtplhdnmyeaaggdkkfyregvfvngaaqgylidkktadqykitniaqlkdpkia
klfdtngdgkadltgcnpgwgcegainhqlaayeltntvthnqgnyaammadtisrykeg
kpvfyytwtpywvsnelkpgkdvvwlqvpfsalpgdknadtklpnganygfpvstmhiva
nkawaeknpaaaklfaimqlpvadinaqnaimhdgkasegdiqghvdgwikahqqqfdgw
vnealaaqk

Timeline for d1r9la_:

• d1r9la_ first appeared in SCOP 1.67
  
• d1r9la_ appears in SCOP 1.73
  
• d1r9la_ appears in SCOPe 2.01
  
• d1r9la_ appears in the current release, SCOPe 2.08