Lineage for d1r8ub_ (1r8u B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067412Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 1067413Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
  5. 1067414Family g.53.1.1: TAZ domain [57934] (1 protein)
  6. 1067415Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 1067416Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)
  8. 1067417Domain d1r8ub_: 1r8u B: [97250]
    Other proteins in same PDB: d1r8ua_
    CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A)
    complexed with zn

Details for d1r8ub_

PDB Entry: 1r8u (more details)

PDB Description: nmr structure of cbp taz1/cited2 complex
PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d1r8ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ub_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
gkacqvahcassrqiishwknctrhdcpvclplknasdkr

SCOPe Domain Coordinates for d1r8ub_:

Click to download the PDB-style file with coordinates for d1r8ub_.
(The format of our PDB-style files is described here.)

Timeline for d1r8ub_: