SCOP 1.75: Domain d1r8ub_: 1r8u B:

Lineage for d1r8ub_ (1r8u B:)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)

5. Family g.53.1.1: TAZ domain [57934] (1 protein)

6. Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75696] (3 PDB entries)

8. Domain d1r8ub_: 1r8u B: [97250]
   Other proteins in same PDB: d1r8ua_
   CH1 (TAZ1) domain; complexed with Cited2 transactivation domain (chain A)
   complexed with zn

Details for d1r8ub_

PDB Entry: 1r8u

PDB Description: nmr structure of cbp taz1/cited2 complex

PDB Compounds: (B:) creb-binding protein

SCOP Domain Sequences for d1r8ub_:

Sequence; same for both SEQRES and ATOM records:

>d1r8ub_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Human (Homo sapiens) [TaxId: 9606]}
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
gkacqvahcassrqiishwknctrhdcpvclplknasdkr

Timeline for d1r8ub_:

• d1r8ub_ first appeared in SCOP 1.67
  
• d1r8ub_ appears in SCOP 1.73
  
• d1r8ub_ appears in SCOPe 2.01
  
• d1r8ub_ appears in the current release, SCOPe 2.08