Lineage for d1r7aa2 (1r7a A:1-434)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830339Protein Sucrose phosphorylase [102060] (1 species)
    sequence and close structural relationship to amylosucrase; variations in the C-terminal domain fold
  7. 2830340Species Bifidobacterium adolescentis [TaxId:1680] [102061] (2 PDB entries)
  8. 2830341Domain d1r7aa2: 1r7a A:1-434 [97193]
    Other proteins in same PDB: d1r7aa1, d1r7ab1
    complexed with trs

Details for d1r7aa2

PDB Entry: 1r7a (more details), 1.77 Å

PDB Description: Sucrose Phosphorylase from Bifidobacterium adolescentis
PDB Compounds: (A:) sucrose phosphorylase

SCOPe Domain Sequences for d1r7aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

SCOPe Domain Coordinates for d1r7aa2:

Click to download the PDB-style file with coordinates for d1r7aa2.
(The format of our PDB-style files is described here.)

Timeline for d1r7aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7aa1