SCOPe 2.08: Domain d1r7aa1: 1r7a A:435-504

Lineage for d1r7aa1 (1r7a A:435-504)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Sucrose phosphorylase [101920] (1 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Bifidobacterium adolescentis [TaxId:1680] [101921] (2 PDB entries)

8. Domain d1r7aa1: 1r7a A:435-504 [97192]
   Other proteins in same PDB: d1r7aa2, d1r7ab2
   complexed with trs
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d1r7aa1

PDB Entry: 1r7a, 1.77 Å

PDB Description: Sucrose Phosphorylase from Bifidobacterium adolescentis

PDB Compounds: (A:) sucrose phosphorylase

SCOPe Domain Sequences for d1r7aa1:

Sequence; same for both SEQRES and ATOM records:

>d1r7aa1 b.71.1.1 (A:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

Timeline for d1r7aa1:

• d1r7aa1 first appeared in SCOP 1.67
  
• d1r7aa1 appears in SCOPe 2.07