Lineage for d1r6wa1 (1r6w A:100-320)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973407Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 973472Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 973629Protein O-succinylbenzoate synthase [51613] (1 species)
  7. 973630Species Escherichia coli [TaxId:562] [51614] (4 PDB entries)
  8. 973631Domain d1r6wa1: 1r6w A:100-320 [97165]
    Other proteins in same PDB: d1r6wa2
    complexed with 164, mg; mutant

Details for d1r6wa1

PDB Entry: 1r6w (more details), 1.62 Å

PDB Description: crystal structure of the k133r mutant of o-succinylbenzoate synthase (osbs) from escherichia coli. complex with shchc
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d1r6wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r6wa1 c.1.11.2 (A:100-320) O-succinylbenzoate synthase {Escherichia coli [TaxId: 562]}
qaanyraaplcngdpddlilkladmpgekvakvrvglyeavrdgmvvnllleaipdlhlr
ldanrawtplkgqqfakyvnpdyrdriafleepcktrddsrafaretgiaiawdeslrep
dfafvaeegvravvikptltgslekvreqvqaahalgltavisssiesslgltqlariaa
wltpdtipgldtldlmqaqqvrrwpgstlpvvevdalerll

SCOPe Domain Coordinates for d1r6wa1:

Click to download the PDB-style file with coordinates for d1r6wa1.
(The format of our PDB-style files is described here.)

Timeline for d1r6wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r6wa2