Lineage for d1r64a2 (1r64 A:121-460)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990724Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 990725Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 990726Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 990749Protein Kexin, N-terminal domain [89692] (1 species)
  7. 990750Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89693] (3 PDB entries)
  8. 990753Domain d1r64a2: 1r64 A:121-460 [97141]
    Other proteins in same PDB: d1r64a1, d1r64b1
    complexed with btb, ca, k, nag

Details for d1r64a2

PDB Entry: 1r64 (more details), 2.2 Å

PDB Description: the 2.2 a crystal structure of kex2 protease in complex with ac-arg- glu-lys-boroarg peptidyl boronic acid inhibitor
PDB Compounds: (A:) Kexin

SCOPe Domain Sequences for d1r64a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r64a2 c.41.1.1 (A:121-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
llpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldy
enedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynaki
sgirilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvteg
rdskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavty
ssgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavg
leknadgdwrdsamgkkyshrygfgkidahkliemsktwe

SCOPe Domain Coordinates for d1r64a2:

Click to download the PDB-style file with coordinates for d1r64a2.
(The format of our PDB-style files is described here.)

Timeline for d1r64a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r64a1