PDB entry 1r64

View 1r64 on RCSB PDB site
Description: The 2.2 A crystal structure of Kex2 protease in complex with Ac-Arg-Glu-Lys-boroArg peptidyl boronic acid inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: kex2, kexin, protease, protein convertase, prohormone processing, proprotein convertase, subtilisin, hydrolase-hydrolase inhibitor complex
Deposited on 2003-10-14, released 2004-03-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kexin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KEX2 OR QDS1 OR YNL238W OR N1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r64a1, d1r64a2
  • Chain 'B':
    Compound: Kexin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: KEX2 OR QDS1 OR YNL238W OR N1122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r64b1, d1r64b2
  • Chain 'C':
    Compound: Ac-Arg-Glu-Lys-boroArg peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R64 (Start-3)
  • Chain 'D':
    Compound: Ac-Arg-Glu-Lys-boroArg peptide inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1R64 (Start-3)
  • Heterogens: NAG, CA, K, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r64A (A:)
    llpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldy
    enedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynaki
    sgirilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvteg
    rdskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavty
    ssgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavg
    leknadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptlyvsqstn
    steetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagiisnlgvvr
    prdvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfgesidsskt
    e
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r64B (B:)
    llpvkeaedklsindplferqwhlvnpsfpgsdinvldlwynnitgagvvaaivddgldy
    enedlkdnfcaegswdfndntnlpkprlsddyhgtrcageiaakkgnnfcgvgvgynaki
    sgirilsgdittedeaasliygldvndiyscswgpaddgrhlqgpsdlvkkalvkgvteg
    rdskgaiyvfasgnggtrgdncnydgytnsiysitigaidhkdlhppysegcsavmavty
    ssgsgeyihssdingrcsnshggtsaaaplaagvytllleanpnltwrdvqylsilsavg
    leknadgdwrdsamgkkyshrygfgkidahkliemsktwenvnaqtwfylptlyvsqstn
    steetlesvitisekslqdanfkriehvtvtvdidteirgtttvdlispagiisnlgvvr
    prdvssegfkdwtfmsvahwgengvgdwkikvkttenghridfhswrlklfgesidsskt
    e
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.