Class a: All alpha proteins [46456] (258 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family) |
Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins) |
Protein Alpha-tocopherol transfer protein [101069] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101070] (3 PDB entries) |
Domain d1r5la1: 1r5l A:25-90 [97099] Other proteins in same PDB: d1r5la2 complexed with viv |
PDB Entry: 1r5l (more details), 1.5 Å
SCOP Domain Sequences for d1r5la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5la1 a.5.3.1 (A:25-90) Alpha-tocopherol transfer protein {Human (Homo sapiens) [TaxId: 9606]} qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis adlhpr
Timeline for d1r5la1: