Lineage for d1r5ia1 (1r5i A:82-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747358Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 2747388Domain d1r5ia1: 1r5i A:82-181 [97087]
    Other proteins in same PDB: d1r5ia2, d1r5ib1, d1r5ib2, d1r5id1, d1r5id2, d1r5ie2, d1r5if1, d1r5if2, d1r5ih1, d1r5ih2
    complexed with po4

Details for d1r5ia1

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1r5ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ia1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOPe Domain Coordinates for d1r5ia1:

Click to download the PDB-style file with coordinates for d1r5ia1.
(The format of our PDB-style files is described here.)

Timeline for d1r5ia1: