![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries) |
![]() | Domain d1r5ia2: 1r5i A:1-81 [97088] Other proteins in same PDB: d1r5ia1, d1r5ib1, d1r5ib2, d1r5id1, d1r5id2, d1r5ie1, d1r5if1, d1r5if2, d1r5ih1, d1r5ih2 complexed with po4 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1r5i (more details), 2.6 Å
SCOPe Domain Sequences for d1r5ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5ia2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal aniavdkanleimtkrsnytp
Timeline for d1r5ia2: