![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein SA2309 [103173] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [103174] (2 PDB entries) |
![]() | Domain d1r57a_: 1r57 A: [97080] structural genomics; NESG target ZR31 |
PDB Entry: 1r57 (more details)
SCOPe Domain Sequences for d1r57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav veharennlkiiascsfakhmlekedsyqdvylglehhhhhh
Timeline for d1r57a_: