Lineage for d1r57a_ (1r57 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214850Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1214851Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1214852Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1215025Protein Hypothetical protein SA2309 [103173] (1 species)
  7. 1215026Species Staphylococcus aureus [TaxId:1280] [103174] (2 PDB entries)
  8. 1215027Domain d1r57a_: 1r57 A: [97080]
    structural genomics; NESG target ZR31

Details for d1r57a_

PDB Entry: 1r57 (more details)

PDB Description: nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus. northeast structural genomics consortium target zr31
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1r57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}
msnleikqgenkfyigddennalaeityrfvdnneinidhtgvsdelggqgvgkkllkav
veharennlkiiascsfakhmlekedsyqdvylglehhhhhh

SCOPe Domain Coordinates for d1r57a_:

Click to download the PDB-style file with coordinates for d1r57a_.
(The format of our PDB-style files is described here.)

Timeline for d1r57a_: