SCOPe 2.08: Domain d1r56b2: 1r56 B:137-295

Lineage for d1r56b2 (1r56 B:137-295)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)

8. Domain d1r56b2: 1r56 B:137-295 [97067]
   complexed with peg

Details for d1r56b2

PDB Entry: 1r56, 2.3 Å

PDB Description: uncomplexed urate oxidase from aspergillus flavus

PDB Compounds: (B:) Uricase

SCOPe Domain Sequences for d1r56b2:

Sequence; same for both SEQRES and ATOM records:

>d1r56b2 d.96.1.4 (B:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

Timeline for d1r56b2:

• d1r56b2 first appeared in SCOP 1.67
  
• d1r56b2 appears in SCOPe 2.07