Lineage for d1r4sa2 (1r4s A:137-296)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)
  8. Domain d1r4sa2: 1r4s A:137-296 [97046]
    complexed with cys, mua

Details for d1r4sa2

PDB Entry: 1r4s (more details), 1.8 Å

PDB Description: urate oxidase from aspergillus flavus complexed with its inhibitor 9- methyl uric acid
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d1r4sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4sa2 d.96.1.4 (A:137-296) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrss

SCOPe Domain Coordinates for d1r4sa2 are not available.

Timeline for d1r4sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r4sa1