Lineage for d1r4pe_ (1r4p E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788585Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2788740Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (1 PDB entry)
  8. 2788744Domain d1r4pe_: 1r4p E: [97029]
    Other proteins in same PDB: d1r4pa_
    complexed with 1ps, edo, fmt, na

Details for d1r4pe_

PDB Entry: 1r4p (more details), 1.77 Å

PDB Description: shiga toxin type 2
PDB Compounds: (E:) shiga-like toxin type II B subunit

SCOPe Domain Sequences for d1r4pe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4pe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d1r4pe_:

Click to download the PDB-style file with coordinates for d1r4pe_.
(The format of our PDB-style files is described here.)

Timeline for d1r4pe_: