Lineage for d1r4pa_ (1r4p A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. Family d.165.1.2: Shiga toxin, A-chain [56395] (2 proteins)
  6. Protein Shiga toxin, A-chain [56396] (5 species)
  7. Species Shigella dysenteriae, toxin II [TaxId:622] [103337] (3 PDB entries)
  8. Domain d1r4pa_: 1r4p A: [97025]
    Other proteins in same PDB: d1r4pb_, d1r4pc_, d1r4pd_, d1r4pe_, d1r4pf_
    complexed with 1ps, edo, fmt, na

Details for d1r4pa_

PDB Entry: 1r4p (more details), 1.7700000000000002 Å

PDB Description: shiga toxin type 2
PDB Compounds: (A:) shiga-like toxin type II A subunit

SCOPe Domain Sequences for d1r4pa_:

Sequence, based on SEQRES records: (download)

>d1r4pa_ d.165.1.2 (A:) Shiga toxin, A-chain {Shigella dysenteriae, toxin II [TaxId: 622]}
reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
chhqgarsvravneesqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk

Sequence, based on observed residues (ATOM records): (download)

>d1r4pa_ d.165.1.2 (A:) Shiga toxin, A-chain {Shigella dysenteriae, toxin II [TaxId: 622]}
reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
checqitgdrpvikinntlwesntaaaflnrksqflyttgk

SCOPe Domain Coordinates for d1r4pa_ are not available.

Timeline for d1r4pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r4pb_, d1r4pc_, d1r4pd_, d1r4pe_, d1r4pf_